LL-37 — Human Cathelicidin Antimicrobial Peptide
also known as Cathelicidin, CAMP, hCAP-18 (precursor)
LL-37 is the only human cathelicidin, combining direct antimicrobial membrane disruption with broad immunomodulatory and wound-healing signalling via FPR2/ALX.
- Sequence
- [LL-37, 37 aa] (37 aa)
- MW
- 4493.3 Da
- Discovered
- 1995
- Receptor
- FPR2/ALX; modulates innate immune signalling; direct membrane disruption against pathogens
- Half-life
- Short plasma; cytotoxic at high concentrations
- Routes
- SC, Topical
Discovery and Background
LL-37 holds a unique position in human immunology: it is the only cathelicidin peptide expressed by our species. The story begins in 1995, when Larrick and colleagues isolated and described a cationic peptide from human neutrophil granules, noting its broad-spectrum antimicrobial properties and its structural similarity to cathelicidins already characterised in other mammals. The peptide takes its name from its primary sequence — it begins with two leucine residues and spans thirty-seven amino acids in total.
The full precursor protein, hCAP-18 (human cationic antimicrobial protein, approximately eighteen kilodaltons), is stored in secondary granules of neutrophils and in epithelial cells of the skin, gut, lung, and urogenital tract. Upon activation — by inflammatory stimuli, wounding, or microbial challenge — serine proteases cleave the C-terminal fragment free, releasing the active LL-37 peptide. The Gallo laboratory at the University of California subsequently provided pivotal characterisation of how LL-37 integrates antimicrobial killing with immunomodulatory roles, repositioning it from a simple defensin-like killer to a true multifunctional host-defence peptide [PMID:12397359].
Understanding that LL-37 is an endogenous human peptide — not a foreign molecule — is central to appreciating its research appeal. The body already deploys it continuously at barrier surfaces, making it a template for therapeutic strategies rather than a wholly novel chemical entity.
Mechanism of Action
LL-37 operates through two parallel and complementary pathways: direct physical disruption of pathogen membranes, and sophisticated immunological signalling through host receptors.
Direct antimicrobial action. LL-37 is amphipathic and cationic at physiological pH. This electrostatic character drives it to preferentially engage the negatively charged lipopolysaccharide (LPS) coat of Gram-negative bacteria and the teichoic acid-rich walls of Gram-positive organisms. Once bound, the peptide inserts into the lipid bilayer and, at sufficient local concentration, induces membrane destabilisation through toroidal pore formation and carpet-model disruption. The result is rapid loss of membrane integrity, leakage of cellular contents, and bacterial death. Because the mechanism is physical rather than receptor-mediated, resistance development is substantially slower than with conventional antibiotics [PMID:16323148].
FPR2/ALX receptor signalling. At sub-lethal concentrations — the range most relevant to systemic and endogenous exposure — LL-37 acts as a ligand for the formyl peptide receptor FPR2 (also designated ALX). This receptor couples through Gi proteins to downstream ERK, Akt, and intracellular calcium cascades. Through FPR2/ALX, LL-37 functions as a potent chemoattractant for neutrophils and monocytes, accelerating the mobilisation of innate immune cells to sites of infection or injury.
Angiogenic signalling. At low concentrations, LL-37 promotes angiogenesis by transactivating the epidermal growth factor receptor (EGFR) and engaging FPRL1-mediated signalling in endothelial cells. This drives proliferation and migration of vascular endothelial cells, supporting capillary formation during tissue repair.
Concentration-dependent cytotoxicity. A crucial dose-response relationship governs LL-37 biology. At high concentrations, the same membrane-disrupting properties that kill bacteria begin to affect mammalian cells, particularly those lacking the protective cholesterol enrichment of healthy plasma membranes. This cytotoxic ceiling defines the upper boundary of safe research dosing and underscores the importance of precise reconstitution and administration protocols.
Vitamin D induction. One of the most compelling aspects of LL-37 biology is its transcriptional regulation by vitamin D. The CAMP gene encoding hCAP-18/LL-37 contains a vitamin D response element in its promoter. Activation of the vitamin D receptor — whether by solar UVB-induced cutaneous synthesis of calcitriol or by dietary supplementation — directly upregulates LL-37 expression in keratinocytes, monocytes, and respiratory epithelium [PMID:17290304]. This mechanistic link provides a molecular explanation for epidemiological observations connecting vitamin D deficiency to increased susceptibility to respiratory and skin infections.
Researched Applications
Wound healing and skin repair. LL-37 participates in all phases of cutaneous wound healing. It reduces bacterial colonisation of open wounds, recruits neutrophils and macrophages during the inflammatory phase, and transitions to a pro-repair role by stimulating keratinocyte migration and proliferation during re-epithelialisation. Topical and intradermal administration in preclinical wound models has consistently demonstrated accelerated closure and reduced infection rates. Research in chronic diabetic and venous ulcer models suggests LL-37 may address both the antimicrobial deficit and the impaired growth-factor signalling characteristic of non-healing wounds [PMID:18483415].
Sepsis adjunct research. The capacity of LL-37 to neutralise LPS — binding and sequestering it before it can engage toll-like receptor four — has generated interest in its potential role alongside conventional sepsis management. Preclinical models show reduced pro-inflammatory cytokine cascades when LL-37 is present during Gram-negative challenge, though translation to human sepsis protocols remains an active area of investigation requiring controlled clinical evidence.
Gut microbiome and inflammatory bowel disease. Epithelial cells lining the colon express hCAP-18 and secrete LL-37 in a gradient that shapes the luminal microbiome. In inflammatory bowel disease, particularly Crohn's disease, LL-37 expression is dysregulated in ways that may compromise barrier defence and permit translocation of commensal organisms. Research into whether restoration of LL-37 activity — through direct peptide administration or through vitamin D repletion — can stabilise this barrier and modulate the dysbiotic microbiome is ongoing.
Dosing Considerations
Research dosing protocols explored in preclinical and early exploratory human contexts typically employ subcutaneous administration at approximately one hundred micrograms on alternating days, constituting a conservative low-dose schedule designed to remain below cytotoxic concentration thresholds while achieving local immunomodulatory effects. Topical formulations for skin and wound applications use concentrations calibrated to remain in the angiogenic and antimicrobial range rather than the cytotoxic range. These figures are drawn from laboratory and research contexts and do not constitute clinical recommendations.
Safety and Adverse Effects
The concentration-dependent nature of LL-37's cytotoxicity is the dominant safety consideration. In the SC route, local injection-site reactions — erythema, mild oedema, and transient stinging — are the most commonly reported adverse effects in research settings, consistent with the peptide's known ability to activate mast cells and trigger localised histamine release via FPR2 and MRGPRX2 receptors.
Systemic cytotoxicity at research doses via the SC route is considered low due to rapid protease-mediated clearance in plasma; however, errors in reconstitution that deliver an overdose represent the principal avoidable risk. LL-37 also has immunostimulatory properties that may exacerbate autoimmune conditions — elevated endogenous LL-37 has been detected in psoriatic lesions, rosacea, and lupus, suggesting that additional exogenous LL-37 could theoretically amplify existing inflammatory pathology in susceptible individuals. Individuals with active autoimmune conditions should not use this compound outside of formal research frameworks.
UK Regulatory Status
LL-37 is not licensed as a medicinal product in the United Kingdom, the United States, or the European Union. It has not completed Phase III clinical trials in any indication and carries no marketing authorisation from the MHRA, FDA, or EMA. Supply, possession, and use in the UK are governed by the Human Medicines Regulations 2012. LL-37 is classified as a research compound for laboratory and in vitro use only. It may not be sold for human administration, and any individual obtaining it does so outside of a regulated therapeutic pathway. Researchers must ensure compliance with their institutional ethics framework and applicable import regulations before procurement.
Reconstitution Protocol
LL-37 lyophilisate is highly sensitive to aggregation and degradation if reconstituted incorrectly. Strict technique is required to avoid producing a preparation with anomalous concentration and consequent cytotoxic risk.
Reconstitute with sterile bacteriostatic water for injection or sterile water for injection, depending on your intended use window. Add diluent slowly down the side of the vial rather than directly onto the lyophilised cake, and swirl gently — never vortex. Allow the vial to stand at room temperature for two to three minutes until fully dissolved; the solution should be clear and colourless. Because LL-37 at high concentration is cytotoxic, confirm the final concentration carefully against the stated peptide content on the certificate of analysis before drawing any volume. Aliquot into single-use volumes if the vial will not be consumed within a single session. Reconstituted peptide should be stored at four degrees Celsius and used within forty-eight hours; lyophilised stock may be held at minus twenty degrees Celsius away from repeated freeze-thaw cycles. Discard any preparation showing particulate matter or discolouration.
Frequently Asked Questions
Is LL-37 the same as hCAP-18? No. hCAP-18 is the larger inactive precursor protein. LL-37 is the active C-terminal fragment released by proteolytic cleavage. When researchers refer to cathelicidin activity, they generally mean LL-37 specifically.
Can vitamin D supplementation raise LL-37 levels without injecting the peptide? Yes, within limits. Vitamin D repletion demonstrably upregulates endogenous CAMP gene expression and has been used in clinical contexts — such as tuberculosis adjunct therapy — as a strategy to boost mucosal LL-37 [PMID:17290304]. However, the magnitude of increase is constrained by physiological regulation and cannot replicate the localised tissue concentrations achievable with direct administration.
Why does LL-37 appear elevated in inflammatory skin diseases? In psoriasis and rosacea, keratinocytes overproduce LL-37, which then acts as an endogenous adjuvant — forming complexes with self-DNA, activating plasmacytoid dendritic cells via toll-like receptor nine, and amplifying the inflammatory loop. This illustrates the dual-edged character of cathelicidin biology and the importance of context-specific dose calibration.
How does LL-37 compare to other antimicrobial peptides under investigation? LL-37 is distinguished by its proven human endogenous origin, its receptor-mediated immunomodulatory activity beyond simple membrane disruption, and its established vitamin D axis. Other antimicrobial peptides (defensins, magainins) may have greater in vitro potency against specific organisms but lack the same depth of human mechanistic data.
Is topical LL-37 research ongoing? Yes. Topical and inhaled formulations are in early-phase clinical investigation for chronic wound management and COPD-associated recurrent infection, representing the most clinically proximate research directions.
Looking to combine LL-37 with complementary gut-barrier peptides? See the KPV + LL-37 Gut Healing Stack for a curated protocol pairing LL-37's antimicrobial and barrier-supportive properties with KPV's anti-inflammatory mucosal action.
Source research-grade LL-37
LL-37 — Human Cathelicidin Antimicrobial Peptide is sold for laboratory and in vitro research use only. UK regulatory status: Unapproved research compound in UK, US, EU. Laboratory and in vitro research use only..
Research stacks containing LL-37
Combinations on this site that include LL-37 as one of their peptides.